联系电话:0551-67163798
*本公司产品仅供体外研究使用,不用于临床诊断!
产品型号 多肽合成
产品厂商 合生生物
产品参数 KG G MG UG
颜色 白黄色粉末
生产商 合肥合生生物
产品参数
产品型号
多肽合成
产品厂商
合生生物
产品参数
KG G MG UG
颜色
白黄色粉末
生产商
合肥合生生物
我知道了
产品详情
NameSequenceQuantityPrice(2mg)¥Price(5mg)¥
c(RGDfC)c(RGDfC)97%500800
c(RGDfK)c(RGDfK)97%500800
c(RGDyC)c(RGDyC)97%500800
c(RGDKC)c(RGDKC)97%500800
iRGDc(CRGDKGPDC)97%10001500
3FlagDYKDDDDKGDYKDDDDKIDYKDDDDK97%5001100
Gastrin 1, humanPyr-GPWLEEEEEAYGWMDF-CONH297%500900
HIV-1 TAT Protein PeptideNH2-YGRKKRRQRRR-COOH97%300700
ß-Amyloid (25-35)NH2-GSNKGAIIGLM-COOH97%300700
MOG35-55MEVGWYRSPFSRVVHLYRNGK97%5001100
α-MSHAc-SYSMEHFRWGKPV-CONH297%300700
Angiopep-2NH2-TFFYGGSRGKRNNFKTEEY-COOH97%5001100
β-Amyloid (1-28)DAEFRHDSGYEVHHQKLVFFAEDVGSNK97%13001600
β-Amyloid (1-40)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV95%20003000
β-Amyloid (25-35)GSNKGAIIGLM97%500900
β-Amyloid (1-42), ratDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA95%35005000
β-Amyloid (1-42), humanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA95%35005000
LL-37[LL-37, 37 aa]95%16502000
Angiotensin I Converting Enzyme InhibitorRPGFSPFR97%500700
Angiotensin Converting Enzyme InhibitorGlp-WPRPQIPP97%500700
Acetalin-3Ac-RFMWMK-NH297%500700
Acetalin-2Ac-RFMWMR-NH297%500700
Acetalin-1Ac-RFMWMT-NH297%500700
ACTH (18-39), humanRPVKVYPNGAEDESAEAFPLEF97%5001100
ACTH (6-24), humanHFRWGKPVGKKRRPVKVYP97%5001100
ACTH (4-10), humanMEHFRWG97%300500
ACTH (4-11), humanMEHFRWGK97%300500
ACTH (1-10), humanSYSMEHFRWG97%500700
ACTH (1-13), humanSYSMEHFRWGKPV97%500700
ACTH (1-16), humanSYSMEHFRWGKPVGKK97%500700
ACTH (1-17), humanSYSMEHFRWGKPVGKKR97%500700
ACTH (1-24), humanSYSMEHFRWGKPVGKKRRPVKVYP97%5001100
ACTH (1-39), humanSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF97%18002000
ACTH (1-39), ratSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF97%18002000
N-Acetyl, ACTH (1-17), humanAc-SYSMEHFRWGKPVGKKR97%8001000
Pro-Adrenomedullin (N-20), ratARLDTSSQFRKKWNKWALSR-NH297%8501000
Pro-Adrenomedullin (N-20), porcineARLDVAAEFRKKWNKWALSR-NH297%8501000
Pro-Adrenomedullin (N-20), humanARLDVASEFRKKWNKWALSR-NH297%8501000
Adrenomedullin (22-52), humanTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH297%13001500
Adrenomedullin (1-12), humanYRQSMNNFQGLR97%500700
Allatostatins/Allatostatin IAPSGAQRLYGFGL-NH297%500700
Allatostatin IVDRLYSFGL-NH297%500700
Allatostatin IIGDGRLYAFGL-NH297%500700
Allatostatin IIIGGSLYSFGL-NH297%500700
Magainin Spacer PeptideDAEAVGPEAFADQDLDEREVR97%8001000
Histatin 5DSHAKRHHGYKRKFHEKHHSHRGY97%10001200
IndolicidinILPWKWPWWPWRR-NH297%500700
Angiotensin III, humanRVYIHPF97%500700
Angiotensin II, humanDRVYIHPF97%500700
Angiotensin I, humanDRVYIHPFHL97%500700
CD36 Peptide P (139-155)CNLAVAAASHIYQNQFVQ97%8001000
Angiotensin II AntipeptideEGVYVHPV97%500700
Angiotensin II (5-8), humanIHPF97%500700
CD36 Peptide P (93-110)YRVRFLAKENVTQDAEDNC97%8001000
Biotinyl-Angiotensin IBiotin-DRVYIHPFHL97%8001000
Fibrinogen-Binding PeptideEHIPA97%500700
Anti-Inflammatory Peptide 1MQMKKVLDS97%500700
Cecropin P1, porcineSWLSKTAKKLENSAKKRISEGIAIAIQGGPR97%14001600
Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2]KWKLFKKIGAVLKVL-NH297%700900
Magainin 2GIGKFLHSAKKFGKAFVGEIMNS97%10001200
Magainin IGIGKFLHSAGKFGKAFVGEIMKS97%10001200
Lactoferricin, bovine, (BLFC)RRWQWRMKKLG97%500700
Apelin-13, human, bovineQRPRLSHKGPMPF97%500700
(Glp1)-Apelin-13, human, bovineGlp-RPRLSHKGPMPF97%500700
α-Bag Cell Peptide (1-7)APRLRFY97%500700
α-Bag Cell Peptide (1-8)APRLRFYS97%500700
α-Bag Cell Peptide (1-9)APRLRFYSL97%500700
γ-Bag Cell FactorRLRFD97%500700
β-Bag Cell FactorRLRFH97%500700
β-Amyloid (1-14)DAEFRHDSGYEVHH97%500700
β-Amyloid (1-13)DAEFRHDSGYEVH97%500700
β-Amyloid (1-12)DAEFRHDSGYEV97%500700
β-Amyloid (1-11)DAEFRHDSGYE97%500700
β-Amyloid (1-10)DAEFRHDSGY97%500700
β-Amyloid (1-9)DAEFRHDSG97%500700
β-Amyloid (1-20)DAEFRHDSGYEVHHQKLVFF97%8501000
β-Amyloid (1-18)DAEFRHDSGYEVHHQKLV97%8501000
BombesinGlp-QRLGNQWAVGHLM-NH297%8501000
Osteocalcin (37-49), humanGFQEAYRRFYGPV97%8501000
Myelopeptide-2 (MP-2)LVVYPW97%500700
Bone Gla Protein (45-49)FYGPV97%500700
[Tyr38, Phe42,46] Bone Gla ProteinYQEAFRRFFGPV97%500700
[Tyr0] BradykininYRPPGFSPFR97%500700
BradykininRPPGFSPFR97%500700
[Thi5,8,DPhe7] BradykininRPPG-Thi-S-DPhe-Thi-R97%500800
CART (55-76), ratIPIYEKKYGQVPMCDAGEQCAV(Cys14&Cys20 bridge)97%8501100
Cholecystokinin, CCK Tetrapeptide (30-33)WMDF-NH297%500700
Cholecystokinin, CCK Octapeptide (26-33), Non-Sulfated formDYMGWMDF-NH297%500700
KatacalcinDMSSDLERDHRPHVSMPQNAN97%8001000
Calcitonin, ratCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (C1&C7 bridge)97%22002500
Calcitonin, humanCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (C1&C7 bridge)97%22002500
Human CMV pp65 (495-503)NLVPMVATV97%500700
a-Helical Corticotropin Releasing Factor (12-41)FHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH297%18002000
Cortistatin 29 (1-13)Glp-ERPPLQQPPHRD97%8001000
Proinsulin C-Peptide (55-89), ?humanRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR97%22002500
SMCY (950-960) (human)SPSVDKARAEL97%500700
Delta-Sleep Inducing PeptideWAGGDASGE97%500700
Dynorphin A (2-17), porcineGGFLRRIRPKLKWDNQ97%8001000
Dynorphin (2-17), amide, porcineGGFLRRIRPKLKWDNQ-NH297%8001000
Dynorphin B (1-9)YGGFLRRQF97%500700
Dynorphin A (1-13), porcineYGGFLRRIRPKLK97%8001000
Dynorphin A (1-13), amide, porcineYGGFLRRIRPKLK-NH297%8001000
Dynorphin A (1-17)YGGFLRRIRPKLKWDNQ97%8001000
Dynorphin A amide, porcineYGGFLRRIRPKLKWDNQ-NH297%8001000
IRL-1720Ac-DKEAVYFAHLDIIW97%8001000
Met-EnkephalinYGGFM97%500700
EXENDIN (9-39)DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH297%18002000
Exendin-4HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH297%18002000
Fibronectin CS1 PeptideEILDVPST97%500700
G-R-G-D-S-PGRGDSP97%500700
Collagen Binding FragmentCQDSETRTFY97%500700
[Glu1] Fibrinopeptide B, humanEGVNDNEEGFFSAR97%500700
[Tyr0] Fibrinopeptide A, humanYADSGEGDFLAEGGGVR97%8001000
FMRF-amideFMRF-NH297%500700
GalantideGWTLNSAGYLLGPQQFFGLM-NH297%8501000
Galanin, ratGWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH297%13001600
Galanin, humanGWTLNSAGYLLGPHAVGNHRSFSDKNGLTS97%13001600
M40GWTLNSAGYLLGPPPALALA-NH297%9001200
M35GWTLNSAGYLLGPPPGFSPFR-NH297%9001200
GHRF (1-29), amide, ratHADAIFTSSYRRILGQLYARKLLHEIMNR-NH297%12501600
GHRF (1-29), amide, humanYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH297%12501600
GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG97%14001700
GLP-1 (7-36), amide, chicken, common turkeyHAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH297%14001700
GLP-1/Glucagon-Like Peptide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG97%16002000
GLP-1/Glucagon-Like Peptide, amide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH297%16002000
[Des-His1,Glu9] Glucagon, amideSQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH297%12001500
GLP-2, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITD97%16002000
Glucagon-Like Peptide II, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITDR97%16002000
Glucagon-Like Peptide II, ratHADGSFSDEMNTILDNLATRDFINWLIQTKITD97%16002000
Glucagon, humanHSQGTFTSDYSKYLDSRRAQDFVQWLMNT97%12501600
Epidermal Growth Factor Receptor Peptide (985-996)DVVDADEYLIPQ97%500700
Brain Derived Acidic Fibroblast Growth Factor (1-11)FNLPLGNYKKP97%500700
Brain Derived Basic Fibroblast Growth Factor (1-24)PALPEDGGSGAFPPGHFKDPKRLY97%10501300
Brain Derived Acidic Fibroblast Growth Factor (102-111)HAEKHWFVGL97%500700
GTP-Binding Protein Fragment, Gs alphaCKQLQKDKQVYRATHR97%500700
Histone H1-derived PeptideGGGPATPKKAKKL97%500700
HIV-1 tat Protein (1-9)MDPVDPNIE97%500700
HIV-1 gag Protein p24 (194-210)ANPDCKTILKALGPAAT97%7501000
HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF)AVGIGALFLGFLGAAGSTMGARS-NH297%10001200
HIV (gp41) FragmentAVGIGA97%500700
HIV (gp120) Fragment (318-327)RGPGRAFVTI97%500700
HIV-1 tat Protein (49-57)RKKRRQRRR97%500700
Laminin (925-933)CDPGYIGSR97%500700
Laminin A Chain (2091-2108)CSRARKQAASIKVAVSADR97%8001000
Laminin (929-933)YIGSR97%500700
Laminin Penta Peptide, amideYIGSR-NH297%500700
Leptin (93-105), humanNVIQISNDLENLR97%500700
Leptin (116-130), mouseSCSLPQTSGLQKPES97%650850
Leucokinin IDPAFNSWG97%500700
[DTrp6]-LH-RH, amideGlp-HWSY-DTrp-LRPG-NH297%500700
LH-RH, Free AcidGlp-HWSYGLRPG97%500700
LH-RH, human, GonadorelineGlp-HWSYGLRPG-NH297%500700
LH-RH, salmonGlp-HWSYGWLPG-NH297%500700
LH-RH, lampreyGlp-HYSLEWKPG-NH297%500700
Mast Cell Degranulating Peptide HR-1INLKAIAALVKKVL-NH297%600800
Mast Cell Degranulating Peptide HR-2FLPLILGKLVKGLL-NH297%600800
Melanocyte-Stimulating Hormone-Release Inhibiting FactorPLG-NH297%500700
MAGE-3 Antigen (167-176), humanMEVDPIGHLY97%500700
MAGE-3 Antigen (271-279), humanFLWGPRALV97%500700
Mage-1 Antigen (161-169), humanEADPTGHSY97%500700
(Met 210) Melanoctye Protein PMEL 17 (209-217) (human)IMDQVPFSV97%500700
Ile-Thr-Asp-Gln-Val-Pro-Phe-Ser-ValITDQVPFSV97%500700
Trp-Asn-Arg-Gln-Leu-Tyr-Pro-Glu-Trp-Thr-Glu-Ala-Gln-Arg-Leu-AspWNRQLYPEWTEAQRLD97%700900
SysteminAVQSKPPSKRDPPKMQTD97%700900
Flag PeptideDYKDDDDK97%500700
OVA 323-339ISQAVHAAHAEINEAGR97%700900
OVA peptide (257-264)SIINFEKL97%500700
Myelin Basic Protein (68-84), guinea pigYGSLPQKSQRSQDEN97%700900
Hexa HisHHHHHH97%500700
Motilin, canineFVPIFTHSELQKIREKERNKGQ97%9501150
Motilin, human, porcineFVPIFTYGELQRMQEKERNKGQ97%9501150
Myelin Basic Protein (87-99) (human, bovine, rat)VHFFKNIVTPRTP97%500700
Neurokinin BDMHDFFVGLM-NH297%500700
Neurokinin A / Substance KHKTDSFVGLM-NH297%500700
Neuromedin CGNHWAVGHLM-NH297%500700
Neuromedin BGNLWATGHFM-NH297%500700
Neuromedin NKIPYIL97%500700
Neuromedin (U25), humanFRVDEEFQSPFASQSRGYFLFRPRN-NH297%11001300
Neuropeptide Y, humanYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH297%16001800
Neuropeptide Y (13-36), humanPAEDMARYYSALRHYINLITRQRY-NH297%11001300
Neuropeptide K, porcineDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH297%16001800
KassininDVPKSDQFVGLM-NH297%700900
NocistatinEQKQLQ97%500700
MastoparanINLKALAALAKKIL-NH297%700900
Mastoparan XINWKGIAAMAKKLL-NH297%700900
Neuropeptide FFFLFQPQRF-NH297%500700
Diazepam-Binding Inhibitor Fragment, humanQATVGDINTERPGMLDFTGK97%8501100
Men 10376DY-DTrp-V-DTrp-DTrp-K-NH297%500700
PhysalaeminGlp-ADPNKFYGLM-NH297%500700
PhyllomedusinGlp-NPNRFIGLM-NH297%500700
CorazoninGlp-TFQYSRGWTN-NH297%500700
Neurotensin (8-13)RRPYIL97%500700
Obestatin (human)FNAPFDVGIKLSGVQYQQHSQAL-NH297%10001300
Nociceptin / Orphanin FQFGGFTGARKSARKLANQ97%7501000
Orexin B, canineRPGPPGLQGRLQRLLQASGNHAAGILTM-NH297%12001500
Orexin B, humanRSGPPGLQGRLQRLLQASGNHAAGILTM-NH297%12001500
PACAP (1-38), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH297%17002000
PACAP-Related Peptide (PRP), ratDVAHEILNEAYRKVLDQLSARKYLQSMVA97%12001500
PACAP-Related Peptide (PRP), humanDVAHGILNEAYRKVLDQLSAGKHLQSLVA97%12001500
PACAP (1-27), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVL-NH297%12001500
PACAP (6-27), human, ovine, ratFTDSYSRYRKQMAVKKYLAAVL-NH297%12001500
Chromostatin, bovineSDEDSDGDRPQASPGLGPGP97%12001500
Pancreatic Polypeptide (rat)APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH297%17002000
Pancreatic Polypeptide (human)APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH297%17002000
Insulin B (9 - 23)SHLVEALYLVCGERG97%650900
PAR - 1 Agonist;Protease - Activated Receptor - 1TFLLRN97%500700
PAR-4 (1-6) amide (human)GYPGQV-NH297%500700
PAR-4 (1-6) (human)GYPGQV97%500700
PAR-4 (1-6) amide (mouse)GYPGKF-NH297%500700
PAR-4 (1-6) (mouse)GYPGKF97%500700
P34cdc2 Kinase Substrate PeptideADAQHATPPKKKRKVEDPKDF97%7501000
Tyrosinase (206-214), humanAFLPWHRLF97%650900
Substrate for Tyrosine Protein KinaseRRLIEDNEYTARG97%650900
S6-1RRLSSLRA97%650900
Phosphate Acceptor PeptideRRKASGPPV97%650900
MalantideRTKRSGSVYEPLKI97%650900
Protease-Activated Receptor-2, PAR-2 Agonist, amideSLIGKV-NH297%650900
MelittinGIGAVLKVLTTGLPALISWIKRKRQQ-NH297%12001500
KemptideLRRASLG97%650900
Phosphorylase Kinase b-Subunit (420-436)KRNPGSQKRFPSNCGRD97%7501000
Myosin Kinase Inhibiting PeptideKKRAARATS-NH297%650900
Syntide 2PLARTLSVAGLPGKK97%650900
Tyrosinase (192-200), human mouseSEIWRDIDF97%650900
Tyr-Ile-Tyr-Gly-Ser-Phe-LysYIYGSFK97%500700
Casein Kinase II SubstrateRRREEETEEE97%650900
Ser25] Protein Kinase C (19-31)RFARKGSLRQKNV97%650900
[Ala9] Autocamtide 2KKALRRQEAVDAL97%650900
Autocamtide 2KKALRRQETVDAL97%650900
cAMP Dependent PK Inhibitor (5-22), amideTTYADFIASGRTGRRNAI-NH297%8001000
RR-SRCRRLIEDAEYAARG97%650900
Protein Kinase C (19-35) PeptideRFARKGALRQKNVHEVK97%8001000
Protein Kinase C (gamma) PeptideNYPLELYERVRTGC97%650900
Hypercalcemia Malignancy Factor (1-34), humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA97%15001800
Hypercalcemia Malignancy Factor (1-34), amide, humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH297%15001800
Parathyroid Hormone (1-34), ratAVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF97%15001800
Parathyroid Hormone (1-34), bovineAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF97%15001800
Angiotensinogen (1-14), humanDRVYIHPFHLVIHN97%650900
Acetyl Angiotensinogen (1-14), porcineAc-DRVYIHPFHLLVYS97%650900
Acetyl, Angiotensinogen (1-14), humanAc-DRVYIHPFHLVIHN97%650900
Renin Substrate Tetradecapeptide, ratDRVYIHPFHLLYYS97%650900
Angiotensinogen (1-14), porcineDRVYIHPFHLLVYS97%650900
Angiotensinogen (1-13), humanDRVYIHPFHLVIH97%650900
P-H-P-F-H-F-F-V-Y-KPHPFHFFVYK97%650900
[Cys8] Renin Substrate Tetradecapeptide, ratDRVYIHPCHLLYYS97%650900
[Leu8] Renin Substrate Tetradecapeptide, ratDRVYIHPLHLLYYS97%650900
[Val8] Renin Substrate Tetradecapeptide, ratDRVYIHPVHLLYYS97%650900
Secretin, ratHSDGTFTSELSRLQDSARLQRLLQGLV-NH297%12001400
Secretin (5-27), porcineTFTSELSRLRDSARLQRLLQGLV-NH297%12001400
Secretin, humanHSDGTFTSELSRLREGARLQRLLQGLV-NH297%12001400
SelankTKPRPGP97%500700
Somatostatin 28 (1-14)SANSNPAMAPRERK97%500700
Somatostatin1-14AGCKNFFWKTFTSC (C3&C14 bridge)97%11001400
RC-160 (Vapreotide)fCYwKVCW-NH2 (C2&C7 bridge)97%11001400
NTB (Naltriben)DPhe-CY-DTrp-Orn-T-Pen-T-NH2(Cys2&Pen7 bridge)97%11001400
[DPro2,DPhe7,DTrp9] Substance PR-DPro-KPQQ-DPhe-F-DTrp-LM-NH297%650900
MG-132RPKPQQFFGLM-NH297%650900
Pep-1KETWWETWWTEWSQPKKKRKV97%9001100
TAT 2-4YGRKKRRQRRRGYGRKKRRQRRRG97%9001200
Scrambled TRAP FragmentFSLLRN-NH297%500700
Hemoglobin (Hb) (64-76)GKKVITAFNEGLK97%500700
Thymopoietin II (32-34)RKD97%500700
Thymopoietin II (32-35)RKDV97%500700
ThymopentinRKDVY97%500700
Urocortin II, humanIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC-NH297%19002200
Urocortin III, mouseFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH297%19002200
Urocortin III, humanFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH297%19002200
Urocortin, humanDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH297%19002200
Urocortin, ratDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH297%19002200
Urocortin III, mouse, free acidFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI97%19002200
Urotensin INDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH297%19002200
VIP, human, porcine, rat, ovineHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH297%12001400
PHI, ratHADGVFTSDYSRLLGQISAKKYLESLI-NH297%12001400
VIP, guinea pigHSDALFTDTYTRLRKQMAMKKYLNSVLN-NH297%12001400
Peptide TASTTTNYT97%500700
R15K, HIV-1 Inhibitory PeptideRIQRGPGRAFVTIGK97%650900



95纯度的参考价:


NameSequenceQuantityWeightPrice
Angiotensin I Converting Enzyme InhibitorRPGFSPFR≥95.0%1mg¥120
Angiotensin I Converting Enzyme InhibitorRPGFSPFR≥95.0%5mg¥360
Angiotensin Converting Enzyme InhibitorGlp-WPRPQIPP≥95.0%1mg¥135
Angiotensin Converting Enzyme InhibitorGlp-WPRPQIPP≥95.0%5mg¥405
Acetalin-3Ac-RFMWMK-NH2≥95.0%1mg¥110
Acetalin-3Ac-RFMWMK-NH2≥95.0%5mg¥330
Acetalin-2Ac-RFMWMR-NH2≥95.0%1mg¥110
Acetalin-2Ac-RFMWMR-NH2≥95.0%5mg¥330
Acetalin-1Ac-RFMWMT-NH2≥95.0%1mg¥110
Acetalin-1Ac-RFMWMT-NH2≥95.0%5mg¥330
ACTH (18-39), humanRPVKVYPNGAEDESAEAFPLEF≥95.0%1mg¥330
ACTH (18-39), humanRPVKVYPNGAEDESAEAFPLEF≥95.0%5mg¥990
ACTH (6-24), humanHFRWGKPVGKKRRPVKVYP≥95.0%1mg¥285
ACTH (6-24), humanHFRWGKPVGKKRRPVKVYP≥95.0%5mg¥285
ACTH (4-10), humanMEHFRWG≥95.0%1mg¥105
ACTH (4-10), humanMEHFRWG≥95.0%5mg¥315
ACTH (4-11), humanMEHFRWGK≥95.0%1mg¥120
ACTH (4-11), humanMEHFRWGK≥95.0%5mg¥360
ACTH (1-10), humanSYSMEHFRWG≥95.0%1mg¥150
ACTH (1-10), humanSYSMEHFRWG≥95.0%5mg¥450
ACTH (1-13), humanSYSMEHFRWGKPV≥95.0%1mg¥165
ACTH (1-13), humanSYSMEHFRWGKPV≥95.0%5mg¥495
ACTH (1-16), humanSYSMEHFRWGKPVGKK≥95.0%1mg¥240
ACTH (1-16), humanSYSMEHFRWGKPVGKK≥95.0%5mg¥720
ACTH (1-17), humanSYSMEHFRWGKPVGKKR≥95.0%1mg¥255
ACTH (1-17), humanSYSMEHFRWGKPVGKKR≥95.0%5mg¥765
ACTH (1-24), humanSYSMEHFRWGKPVGKKRRPVKVYP≥95.0%1mg¥360
ACTH (1-24), humanSYSMEHFRWGKPVGKKRRPVKVYP≥95.0%5mg¥1,080
ACTH (1-39), humanSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF≥95.0%1mg¥624
ACTH (1-39), humanSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF≥95.0%5mg¥1,872
ACTH (1-39), ratSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF≥95.0%1mg¥624
ACTH (1-39), ratSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF≥95.0%5mg¥1,872
N-Acetyl, ACTH (1-17), humanAc-SYSMEHFRWGKPVGKKR≥95.0%1mg¥255
N-Acetyl, ACTH (1-17), humanAc-SYSMEHFRWGKPVGKKR≥95.0%5mg¥765
Pro-Adrenomedullin (N-20), ratARLDTSSQFRKKWNKWALSR-NH2≥95.0%1mg¥312
Pro-Adrenomedullin (N-20), ratARLDTSSQFRKKWNKWALSR-NH2≥95.0%5mg¥936
Pro-Adrenomedullin (N-20), porcineARLDVAAEFRKKWNKWALSR-NH2≥95.0%1mg¥312
Pro-Adrenomedullin (N-20), porcineARLDVAAEFRKKWNKWALSR-NH2≥95.0%5mg¥936
Pro-Adrenomedullin (N-20), humanARLDVASEFRKKWNKWALSR-NH2≥95.0%1mg¥312
Pro-Adrenomedullin (N-20), humanARLDVASEFRKKWNKWALSR-NH2≥95.0%5mg¥936
Adrenomedullin (22-52), humanTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2≥95.0%1mg¥527
Adrenomedullin (22-52), humanTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2≥95.0%5mg¥1,581
Adrenomedullin (1-12), humanYRQSMNNFQGLR≥95.0%1mg¥120
Adrenomedullin (1-12), humanYRQSMNNFQGLR≥95.0%5mg¥360
Allatostatins/Allatostatin IAPSGAQRLYGFGL-NH2≥95.0%1mg¥205
Allatostatins/Allatostatin IAPSGAQRLYGFGL-NH2≥95.0%5mg¥615
Allatostatin IVDRLYSFGL-NH2≥95.0%1mg¥130
Allatostatin IVDRLYSFGL-NH2≥95.0%5mg¥390
Allatostatin IIGDGRLYAFGL-NH2≥95.0%1mg¥160
Allatostatin IIGDGRLYAFGL-NH2≥95.0%5mg¥480
Allatostatin IIIGGSLYSFGL-NH2≥95.0%1mg¥145
Allatostatin IIIGGSLYSFGL-NH2≥95.0%5mg¥435
Magainin Spacer PeptideDAEAVGPEAFADQDLDEREVR≥95.0%1mg¥316
Magainin Spacer PeptideDAEAVGPEAFADQDLDEREVR≥95.0%5mg¥948
Histatin 5DSHAKRHHGYKRKFHEKHHSHRGY≥95.0%1mg¥360
Histatin 5DSHAKRHHGYKRKFHEKHHSHRGY≥95.0%5mg¥1,080
IndolicidinILPWKWPWWPWRR-NH2≥95.0%1mg¥205
IndolicidinILPWKWPWWPWRR-NH2≥95.0%5mg¥615
Angiotensin III, humanRVYIHPF≥95.0%1mg¥105
Angiotensin III, humanRVYIHPF≥95.0%5mg¥315
Angiotensin II, humanDRVYIHPF≥95.0%1mg¥120
Angiotensin II, humanDRVYIHPF≥95.0%5mg¥360
Angiotensin I, humanDRVYIHPFHL≥95.0%1mg¥150
Angiotensin I, humanDRVYIHPFHL≥95.0%5mg¥450
CD36 Peptide P (139-155)CNLAVAAASHIYQNQFVQ≥95.0%1mg¥255
CD36 Peptide P (139-155)CNLAVAAASHIYQNQFVQ≥95.0%5mg¥765
Angiotensin II AntipeptideEGVYVHPV≥95.0%1mg¥120
Angiotensin II AntipeptideEGVYVHPV≥95.0%5mg¥360
Angiotensin II (5-8), humanIHPF≥95.0%1mg¥60
Angiotensin II (5-8), humanIHPF≥95.0%5mg¥180
CD36 Peptide P (93-110)YRVRFLAKENVTQDAEDNC≥95.0%1mg¥270
CD36 Peptide P (93-110)YRVRFLAKENVTQDAEDNC≥95.0%5mg¥810
Biotinyl-Angiotensin IBiotin-DRVYIHPFHL≥95.0%1mg¥175
Biotinyl-Angiotensin IBiotin-DRVYIHPFHL≥95.0%5mg¥525
Fibrinogen-Binding PeptideEHIPA≥95.0%1mg¥75
Fibrinogen-Binding PeptideEHIPA≥95.0%5mg¥225
Anti-Inflammatory Peptide 1MQMKKVLDS≥95.0%1mg¥135
Anti-Inflammatory Peptide 1MQMKKVLDS≥95.0%5mg¥405
Cecropin P1, porcineSWLSKTAKKLENSAKKRISEGIAIAIQGGPR≥95.0%1mg¥480
Cecropin P1, porcineSWLSKTAKKLENSAKKRISEGIAIAIQGGPR≥95.0%5mg¥1,440
Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2]KWKLFKKIGAVLKVL-NH2≥95.0%1mg¥235
Cecropin A-melittin hybrid peptide [CA(1-7)M(2-9)NH2]KWKLFKKIGAVLKVL-NH2≥95.0%5mg¥705
Magainin 2GIGKFLHSAKKFGKAFVGEIMNS≥95.0%1mg¥368
Magainin 2GIGKFLHSAKKFGKAFVGEIMNS≥95.0%5mg¥1,104
Magainin IGIGKFLHSAGKFGKAFVGEIMKS≥95.0%1mg¥368
Magainin IGIGKFLHSAGKFGKAFVGEIMKS≥95.0%5mg¥1,104
Lactoferricin, bovine, (BLFC)RRWQWRMKKLG≥95.0%1mg¥165
Lactoferricin, bovine, (BLFC)RRWQWRMKKLG≥95.0%5mg¥495
Apelin-13, human, bovineQRPRLSHKGPMPF≥95.0%1mg¥195
Apelin-13, human, bovineQRPRLSHKGPMPF≥95.0%5mg¥585
(Glp1)-Apelin-13, human, bovineGlp-RPRLSHKGPMPF≥95.0%1mg¥220
(Glp1)-Apelin-13, human, bovineGlp-RPRLSHKGPMPF≥95.0%5mg¥660
α-Bag Cell Peptide (1-7)APRLRFY≥95.0%1mg¥105
α-Bag Cell Peptide (1-7)APRLRFY≥95.0%5mg¥315
α-Bag Cell Peptide (1-8)APRLRFYS≥95.0%1mg¥120
α-Bag Cell Peptide (1-8)APRLRFYS≥95.0%5mg¥360
α-Bag Cell Peptide (1-9)APRLRFYSL≥95.0%1mg¥135
α-Bag Cell Peptide (1-9)APRLRFYSL≥95.0%5mg¥405
γ-Bag Cell FactorRLRFD≥95.0%1mg¥75
γ-Bag Cell FactorRLRFD≥95.0%5mg¥225
β-Bag Cell FactorRLRFH≥95.0%1mg¥75
β-Bag Cell FactorRLRFH≥95.0%5mg¥225
β-Amyloid (1-14)DAEFRHDSGYEVHH≥95.0%1mg¥280
β-Amyloid (1-14)DAEFRHDSGYEVHH≥95.0%5mg¥840
β-Amyloid (1-13)DAEFRHDSGYEVH≥95.0%1mg¥260
β-Amyloid (1-13)DAEFRHDSGYEVH≥95.0%5mg¥780
β-Amyloid (1-12)DAEFRHDSGYEV≥95.0%1mg¥240
β-Amyloid (1-12)DAEFRHDSGYEV≥95.0%5mg¥720
β-Amyloid (1-11)DAEFRHDSGYE≥95.0%1mg¥220
β-Amyloid (1-11)DAEFRHDSGYE≥95.0%5mg¥660
β-Amyloid (1-10)DAEFRHDSGY≥95.0%1mg¥200
β-Amyloid (1-10)DAEFRHDSGY≥95.0%5mg¥600
β-Amyloid (1-9)DAEFRHDSG≥95.0%1mg¥180
β-Amyloid (1-9)DAEFRHDSG≥95.0%5mg¥540
β-Amyloid (1-20)DAEFRHDSGYEVHHQKLVFF≥95.0%1mg¥400
β-Amyloid (1-20)DAEFRHDSGYEVHHQKLVFF≥95.0%5mg¥1,200
β-Amyloid (1-18)DAEFRHDSGYEVHHQKLV≥95.0%1mg¥360
β-Amyloid (1-18)DAEFRHDSGYEVHHQKLV≥95.0%5mg¥1,080
BombesinGlp-QRLGNQWAVGHLM-NH2≥95.0%1mg¥254
BombesinGlp-QRLGNQWAVGHLM-NH2≥95.0%5mg¥762
Osteocalcin (37-49), humanGFQEAYRRFYGPV≥95.0%1mg¥195
Osteocalcin (37-49), humanGFQEAYRRFYGPV≥95.0%5mg¥585
Myelopeptide-2 (MP-2)LVVYPW≥95.0%1mg¥90
Myelopeptide-2 (MP-2)LVVYPW≥95.0%5mg¥270
Bone Gla Protein (45-49)FYGPV≥95.0%1mg¥75
Bone Gla Protein (45-49)FYGPV≥95.0%5mg¥225
[Tyr38, Phe42,46] Bone Gla ProteinYQEAFRRFFGPV≥95.0%1mg¥180
[Tyr38, Phe42,46] Bone Gla ProteinYQEAFRRFFGPV≥95.0%5mg¥540
[Tyr0] BradykininYRPPGFSPFR≥95.0%1mg¥150
[Tyr0] BradykininYRPPGFSPFR≥95.0%5mg¥450
BradykininRPPGFSPFR≥95.0%1mg¥135
BradykininRPPGFSPFR≥95.0%5mg¥405
[Thi5,8,DPhe7] BradykininRPPG-Thi-S-DPhe-Thi-R≥95.0%1mg¥210
[Thi5,8,DPhe7] BradykininRPPG-Thi-S-DPhe-Thi-R≥95.0%5mg¥630
Fam-Bradykinin5FAM-RPPGFSPFR≥95.0%1mg¥235
Fam-Bradykinin5FAM-RPPGFSPFR≥95.0%5mg¥705
CART (55-76), ratIPIYEKKYGQVPMCDAGEQCAV(Cys14&Cys20 bridge)≥95.0%1mg¥352
CART (55-76), ratIPIYEKKYGQVPMCDAGEQCAV(Cys14&Cys20 bridge)≥95.0%5mg¥1,056
Cholecystokinin, CCK Tetrapeptide (30-33)WMDF-NH2≥95.0%1mg¥70
Cholecystokinin, CCK Tetrapeptide (30-33)WMDF-NH2≥95.0%5mg¥210
Cholecystokinin, CCK Octapeptide (26-33), Non-Sulfated formDYMGWMDF-NH2≥95.0%1mg¥130
Cholecystokinin, CCK Octapeptide (26-33), Non-Sulfated formDYMGWMDF-NH2≥95.0%5mg¥390
KatacalcinDMSSDLERDHRPHVSMPQNAN≥95.0%1mg¥315
KatacalcinDMSSDLERDHRPHVSMPQNAN≥95.0%5mg¥945
Calcitonin, ratCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (C1&C7 bridge)≥95.0%1mg¥664
Calcitonin, ratCGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (C1&C7 bridge)≥95.0%5mg¥1,992
Calcitonin, humanCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (C1&C7 bridge)≥95.0%1mg¥664
Calcitonin, humanCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (C1&C7 bridge)≥95.0%5mg¥1,992
Human CMV pp65 (495-503)NLVPMVATV≥95.0%1mg¥135
Human CMV pp65 (495-503)NLVPMVATV≥95.0%5mg¥405
a-Helical Corticotropin Releasing Factor (12-41)FHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2≥95.0%1mg¥492
a-Helical Corticotropin Releasing Factor (12-41)FHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2≥95.0%5mg¥1,476
Cortistatin 29 (1-13)Glp-ERPPLQQPPHRD≥95.0%1mg¥195
Cortistatin 29 (1-13)Glp-ERPPLQQPPHRD≥95.0%5mg¥585
Proinsulin C-Peptide (55-89), ?humanRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR≥95.0%1mg¥630
Proinsulin C-Peptide (55-89), ?humanRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR≥95.0%5mg¥1,890
SMCY (950-960) (human)SPSVDKARAEL≥95.0%1mg¥165
SMCY (950-960) (human)SPSVDKARAEL≥95.0%5mg¥495
Delta-Sleep Inducing PeptideWAGGDASGE≥95.0%1mg¥135
Delta-Sleep Inducing PeptideWAGGDASGE≥95.0%5mg¥405
DISPWAGGDASGE≥98.0%1mg¥162
DISPWAGGDASGE≥98.0%5mg¥486
Dynorphin A (2-17), porcineGGFLRRIRPKLKWDNQ≥95.0%1mg¥240
Dynorphin A (2-17), porcineGGFLRRIRPKLKWDNQ≥95.0%5mg¥720
Dynorphin (2-17), amide, porcineGGFLRRIRPKLKWDNQ-NH2≥95.0%1mg¥250
Dynorphin (2-17), amide, porcineGGFLRRIRPKLKWDNQ-NH2≥95.0%5mg¥750
Dynorphin B (1-9)YGGFLRRQF≥95.0%1mg¥135
Dynorphin B (1-9)YGGFLRRQF≥95.0%5mg¥405
Dynorphin A (1-13), porcineYGGFLRRIRPKLK≥95.0%1mg¥195
Dynorphin A (1-13), porcineYGGFLRRIRPKLK≥95.0%5mg¥585
Dynorphin A (1-13), amide, porcineYGGFLRRIRPKLK-NH2≥95.0%1mg¥205
Dynorphin A (1-13), amide, porcineYGGFLRRIRPKLK-NH2≥95.0%5mg¥615
Dynorphin A (1-17)YGGFLRRIRPKLKWDNQ≥95.0%1mg¥255
Dynorphin A (1-17)YGGFLRRIRPKLKWDNQ≥95.0%5mg¥765
Dynorphin A amide, porcineYGGFLRRIRPKLKWDNQ-NH2≥95.0%1mg¥265
Dynorphin A amide, porcineYGGFLRRIRPKLKWDNQ-NH2≥95.0%5mg¥795
IRL-1720Ac-DKEAVYFAHLDIIW≥95.0%1mg¥225
IRL-1720Ac-DKEAVYFAHLDIIW≥95.0%5mg¥675
Met-EnkephalinYGGFM≥95.0%1mg¥75
Met-EnkephalinYGGFM≥95.0%5mg¥225
EXENDIN (9-39)DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2≥95.0%1mg¥527
EXENDIN (9-39)DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2≥95.0%5mg¥1,581
Exendin-4HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2≥95.0%1mg¥720
Exendin-4HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2≥95.0%5mg¥2,160
Fibronectin CS1 PeptideEILDVPST≥95.0%1mg¥120
Fibronectin CS1 PeptideEILDVPST≥95.0%5mg¥360
G-R-G-D-S-PGRGDSP≥95.0%1mg¥90
G-R-G-D-S-PGRGDSP≥95.0%5mg¥270
Collagen Binding FragmentCQDSETRTFY≥95.0%1mg¥150
Collagen Binding FragmentCQDSETRTFY≥95.0%5mg¥450
[Glu1] Fibrinopeptide B, humanEGVNDNEEGFFSAR≥95.0%1mg¥210
[Glu1] Fibrinopeptide B, humanEGVNDNEEGFFSAR≥95.0%5mg¥630
[Tyr0] Fibrinopeptide A, humanYADSGEGDFLAEGGGVR≥95.0%1mg¥255
[Tyr0] Fibrinopeptide A, humanYADSGEGDFLAEGGGVR≥95.0%5mg¥765
FMRF-amideFMRF-NH2≥95.0%1mg¥70
FMRF-amideFMRF-NH2≥95.0%5mg¥210
GalantideGWTLNSAGYLLGPQQFFGLM-NH2≥95.0%1mg¥330
GalantideGWTLNSAGYLLGPQQFFGLM-NH2≥95.0%5mg¥990
Galanin, ratGWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2≥95.0%1mg¥474
Galanin, ratGWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2≥95.0%5mg¥1,422
Galanin, humanGWTLNSAGYLLGPHAVGNHRSFSDKNGLTS≥95.0%1mg¥510
Galanin, humanGWTLNSAGYLLGPHAVGNHRSFSDKNGLTS≥95.0%5mg¥1,530
M40GWTLNSAGYLLGPPPALALA-NH2≥95.0%1mg¥310
M40GWTLNSAGYLLGPPPALALA-NH2≥95.0%5mg¥930
M35GWTLNSAGYLLGPPPGFSPFR-NH2≥95.0%1mg¥326
M35GWTLNSAGYLLGPPPGFSPFR-NH2≥95.0%5mg¥978
GHRF (1-29), amide, ratHADAIFTSSYRRILGQLYARKLLHEIMNR-NH2≥95.0%1mg¥474
GHRF (1-29), amide, ratHADAIFTSSYRRILGQLYARKLLHEIMNR-NH2≥95.0%5mg¥1,422
GHRF (1-29), amide, humanYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2≥95.0%1mg¥474
GHRF (1-29), amide, humanYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2≥95.0%5mg¥1,422
GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG≥95.0%1mg¥527
GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG≥95.0%5mg¥1,581
GLP-1 (7-36), amide, chicken, common turkeyHAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2≥95.0%1mg¥510
GLP-1 (7-36), amide, chicken, common turkeyHAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2≥95.0%5mg¥1,530
GLP-1/Glucagon-Like Peptide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG≥95.0%1mg¥660
GLP-1/Glucagon-Like Peptide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG≥95.0%5mg¥1,980
GLP-1/Glucagon-Like Peptide, amide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2≥95.0%1mg¥680
GLP-1/Glucagon-Like Peptide, amide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2≥95.0%5mg¥2,040
[Des-His1,Glu9] Glucagon, amideSQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2≥95.0%1mg¥680
[Des-His1,Glu9] Glucagon, amideSQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2≥95.0%5mg¥2,040
GLP-2, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITD≥95.0%1mg¥561
GLP-2, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITD≥95.0%5mg¥1,683
Glucagon-Like Peptide II, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITDR≥95.0%1mg¥578
Glucagon-Like Peptide II, humanHADGSFSDEMNTILDNLAARDFINWLIQTKITDR≥95.0%5mg¥1,734
Glucagon-Like Peptide II, ratHADGSFSDEMNTILDNLATRDFINWLIQTKITD≥95.0%1mg¥561
Glucagon-Like Peptide II, ratHADGSFSDEMNTILDNLATRDFINWLIQTKITD≥95.0%5mg¥1,683
Glucagon, humanHSQGTFTSDYSKYLDSRRAQDFVQWLMNT≥95.0%1mg¥464
Glucagon, humanHSQGTFTSDYSKYLDSRRAQDFVQWLMNT≥95.0%5mg¥1,392
Epidermal Growth Factor Receptor Peptide (985-996)DVVDADEYLIPQ≥95.0%1mg¥180
Epidermal Growth Factor Receptor Peptide (985-996)DVVDADEYLIPQ≥95.0%5mg¥540
Brain Derived Acidic Fibroblast Growth Factor (1-11)FNLPLGNYKKP≥95.0%1mg¥165
Brain Derived Acidic Fibroblast Growth Factor (1-11)FNLPLGNYKKP≥95.0%5mg¥495
Brain Derived Basic Fibroblast Growth Factor (1-24)PALPEDGGSGAFPPGHFKDPKRLY≥95.0%1mg¥360
Brain Derived Basic Fibroblast Growth Factor (1-24)PALPEDGGSGAFPPGHFKDPKRLY≥95.0%5mg¥1,080
Brain Derived Acidic Fibroblast Growth Factor (102-111)HAEKHWFVGL≥95.0%1mg¥150
Brain Derived Acidic Fibroblast Growth Factor (102-111)HAEKHWFVGL≥95.0%5mg¥450
GTP-Binding Protein Fragment, Gs alphaCKQLQKDKQVYRATHR≥95.0%1mg¥240
GTP-Binding Protein Fragment, Gs alphaCKQLQKDKQVYRATHR≥95.0%5mg¥720
Histone H1-derived PeptideGGGPATPKKAKKL≥95.0%1mg¥165
Histone H1-derived PeptideGGGPATPKKAKKL≥95.0%5mg¥495
HIV-1 tat Protein (1-9)MDPVDPNIE≥95.0%1mg¥135
HIV-1 tat Protein (1-9)MDPVDPNIE≥95.0%5mg¥405
HIV-1 gag Protein p24 (194-210)ANPDCKTILKALGPAAT≥95.0%1mg¥255
HIV-1 gag Protein p24 (194-210)ANPDCKTILKALGPAAT≥95.0%5mg¥765
HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF)AVGIGALFLGFLGAAGSTMGARS-NH2≥95.0%1mg¥378
HIV-1 env Protein gp41 (1-23) amide (isolates BRU/JRCSF)AVGIGALFLGFLGAAGSTMGARS-NH2≥95.0%5mg¥1,134
HIV (gp41) FragmentAVGIGA≥95.0%1mg¥120
HIV (gp41) FragmentAVGIGA≥95.0%5mg¥360
HIV (gp120) Fragment (318-327)RGPGRAFVTI≥95.0%1mg¥150
HIV (gp120) Fragment (318-327)RGPGRAFVTI≥95.0%5mg¥450
HIV-1 tat Protein (49-57)RKKRRQRRR≥95.0%1mg¥135
HIV-1 tat Protein (49-57)RKKRRQRRR≥95.0%5mg¥405
Laminin (925-933)CDPGYIGSR≥95.0%1mg¥135
Laminin (925-933)CDPGYIGSR≥95.0%5mg¥405
Laminin A Chain (2091-2108)CSRARKQAASIKVAVSADR≥95.0%1mg¥270
Laminin A Chain (2091-2108)CSRARKQAASIKVAVSADR≥95.0%5mg¥810
Laminin (929-933)YIGSR≥95.0%1mg¥75
Laminin (929-933)YIGSR≥95.0%5mg¥225
Laminin Penta Peptide, amideYIGSR-NH2≥95.0%1mg¥85
Laminin Penta Peptide, amideYIGSR-NH2≥95.0%5mg¥255




名称序列(一个字母)纯度¥参考价
Leptin (93-105), humanNVIQISNDLENLR≥95.0%1mg¥195
Leptin (93-105), humanNVIQISNDLENLR≥95.0%5mg¥585
Leptin (116-130), mouseSCSLPQTSGLQKPES≥95.0%1mg¥225
Leptin (116-130), mouseSCSLPQTSGLQKPES≥95.0%5mg¥675
Leucokinin IDPAFNSWG≥95.0%1mg¥130
Leucokinin IDPAFNSWG≥95.0%5mg¥390
[DTrp6]-LH-RH, amideGlp-HWSY-DTrp-LRPG-NH2≥95.0%1mg¥210
[DTrp6]-LH-RH, amideGlp-HWSY-DTrp-LRPG-NH2≥95.0%5mg¥630
LH-RH, Free AcidGlp-HWSYGLRPG≥95.0%1mg¥165
LH-RH, Free AcidGlp-HWSYGLRPG≥95.0%5mg¥495
LH-RH, human, GonadorelineGlp-HWSYGLRPG-NH2≥95.0%1mg¥175
LH-RH, human, GonadorelineGlp-HWSYGLRPG-NH2≥95.0%5mg¥525
LH-RH, salmonGlp-HWSYGWLPG-NH2≥95.0%1mg¥175
LH-RH, salmonGlp-HWSYGWLPG-NH2≥95.0%5mg¥525
LH-RH, lampreyGlp-HYSLEWKPG-NH2≥95.0%1mg¥175
LH-RH, lampreyGlp-HYSLEWKPG-NH2≥95.0%5mg¥525
Mast Cell Degranulating Peptide HR-1INLKAIAALVKKVL-NH2≥95.0%1mg¥225
Mast Cell Degranulating Peptide HR-1INLKAIAALVKKVL-NH2≥95.0%5mg¥675
Mast Cell Degranulating Peptide HR-2FLPLILGKLVKGLL-NH2≥95.0%1mg¥225
Mast Cell Degranulating Peptide HR-2FLPLILGKLVKGLL-NH2≥95.0%5mg¥675
Melanocyte-Stimulating Hormone-Release Inhibiting FactorPLG-NH2≥95.0%1mg¥55
Melanocyte-Stimulating Hormone-Release Inhibiting FactorPLG-NH2≥95.0%5mg¥165
MAGE-3 Antigen (167-176), humanMEVDPIGHLY≥95.0%1mg¥150
MAGE-3 Antigen (167-176), humanMEVDPIGHLY≥95.0%5mg¥450
MAGE-3 Antigen (271-279), humanFLWGPRALV≥95.0%1mg¥135
MAGE-3 Antigen (271-279), humanFLWGPRALV≥95.0%5mg¥405
Mage-1 Antigen (161-169), humanEADPTGHSY≥95.0%1mg¥135
Mage-1 Antigen (161-169), humanEADPTGHSY≥95.0%5mg¥405
(Met 210) Melanoctye Protein PMEL 17 (209-217) (human)IMDQVPFSV≥95.0%1mg¥135
(Met 210) Melanoctye Protein PMEL 17 (209-217) (human)IMDQVPFSV≥95.0%5mg¥405
Ile-Thr-Asp-Gln-Val-Pro-Phe-Ser-ValITDQVPFSV≥95.0%1mg¥135
Ile-Thr-Asp-Gln-Val-Pro-Phe-Ser-ValITDQVPFSV≥95.0%5mg¥405
Trp-Asn-Arg-Gln-Leu-Tyr-Pro-Glu-Trp-Thr-Glu-Ala-Gln-Arg-Leu-AspWNRQLYPEWTEAQRLD≥95.0%1mg¥240
Trp-Asn-Arg-Gln-Leu-Tyr-Pro-Glu-Trp-Thr-Glu-Ala-Gln-Arg-Leu-AspWNRQLYPEWTEAQRLD≥95.0%5mg¥720
SysteminAVQSKPPSKRDPPKMQTD≥95.0%1mg¥270
SysteminAVQSKPPSKRDPPKMQTD≥95.0%5mg¥810
Flag PeptideDYKDDDDK≥95.0%1mg¥120
Flag PeptideDYKDDDDK≥95.0%5mg¥360
OVA 323-339ISQAVHAAHAEINEAGR≥95.0%1mg¥272
OVA 323-339ISQAVHAAHAEINEAGR≥95.0%5mg¥816
OVA peptide (257-264)SIINFEKL≥95.0%1mg¥120
OVA peptide (257-264)SIINFEKL≥95.0%5mg¥360
Myelin Basic Protein (68-84), guinea pigYGSLPQKSQRSQDEN≥95.0%1mg¥225
Myelin Basic Protein (68-84), guinea pigYGSLPQKSQRSQDEN≥95.0%5mg¥675
Hexa HisHHHHHH≥95.0%1mg¥120
Hexa HisHHHHHH≥95.0%5mg¥360
MOG 35-55MEVGWYRSPFSRVVHLYRNGK≥95.0%1mg¥336
MOG 35-55MEVGWYRSPFSRVVHLYRNGK≥95.0%5mg¥1,008
Motilin, canineFVPIFTHSELQKIREKERNKGQ≥95.0%1mg¥330
Motilin, canineFVPIFTHSELQKIREKERNKGQ≥95.0%5mg¥990
Motilin, human, porcineFVPIFTYGELQRMQEKERNKGQ≥95.0%1mg¥352
Motilin, human, porcineFVPIFTYGELQRMQEKERNKGQ≥95.0%5mg¥1,056
Myelin Basic Protein (87-99) (human, bovine, rat)VHFFKNIVTPRTP≥95.0%1mg¥195
Myelin Basic Protein (87-99) (human, bovine, rat)VHFFKNIVTPRTP≥95.0%5mg¥585
Neurokinin BDMHDFFVGLM-NH2≥95.0%1mg¥165
Neurokinin BDMHDFFVGLM-NH2≥95.0%5mg¥495
Neurokinin A / Substance KHKTDSFVGLM-NH2≥95.0%1mg¥160
Neurokinin A / Substance KHKTDSFVGLM-NH2≥95.0%5mg¥480
Neuromedin CGNHWAVGHLM-NH2≥95.0%1mg¥160
Neuromedin CGNHWAVGHLM-NH2≥95.0%5mg¥480
Neuromedin BGNLWATGHFM-NH2≥95.0%1mg¥160
Neuromedin BGNLWATGHFM-NH2≥95.0%5mg¥480
Neuromedin NKIPYIL≥95.0%1mg¥90
Neuromedin NKIPYIL≥95.0%5mg¥270
Neuromedin (U25), humanFRVDEEFQSPFASQSRGYFLFRPRN-NH2≥95.0%1mg¥400
Neuromedin (U25), humanFRVDEEFQSPFASQSRGYFLFRPRN-NH2≥95.0%5mg¥1,200
Neuropeptide Y, humanYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2≥95.0%1mg¥664
Neuropeptide Y, humanYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2≥95.0%5mg¥1,992
Neuropeptide Y (13-36), humanPAEDMARYYSALRHYINLITRQRY-NH2≥95.0%1mg¥360
Neuropeptide Y (13-36), humanPAEDMARYYSALRHYINLITRQRY-NH2≥95.0%5mg¥1,080
Neuropeptide K, porcineDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2≥95.0%1mg¥598
Neuropeptide K, porcineDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2≥95.0%5mg¥1,794
KassininDVPKSDQFVGLM-NH2≥95.0%1mg¥195
KassininDVPKSDQFVGLM-NH2≥95.0%5mg¥585
NocistatinEQKQLQ≥95.0%1mg¥90
NocistatinEQKQLQ≥95.0%5mg¥270
MastoparanINLKALAALAKKIL-NH2≥95.0%1mg¥220
MastoparanINLKALAALAKKIL-NH2≥95.0%5mg¥660
Mastoparan XINWKGIAAMAKKLL-NH2≥95.0%1mg¥220
Mastoparan XINWKGIAAMAKKLL-NH2≥95.0%5mg¥660
Neuropeptide FFFLFQPQRF-NH2≥95.0%1mg¥130
Neuropeptide FFFLFQPQRF-NH2≥95.0%5mg¥390
Diazepam-Binding Inhibitor Fragment, humanQATVGDINTERPGMLDFTGK≥95.0%1mg¥320
Diazepam-Binding Inhibitor Fragment, humanQATVGDINTERPGMLDFTGK≥95.0%5mg¥960
Men 10376DY-DTrp-V-DTrp-DTrp-K-NH2≥95.0%1mg¥205
Men 10376DY-DTrp-V-DTrp-DTrp-K-NH2≥95.0%5mg¥615
PhysalaeminGlp-ADPNKFYGLM-NH2≥95.0%1mg¥205
PhysalaeminGlp-ADPNKFYGLM-NH2≥95.0%5mg¥615
PhyllomedusinGlp-NPNRFIGLM-NH2≥95.0%1mg¥190
PhyllomedusinGlp-NPNRFIGLM-NH2≥95.0%5mg¥570
CorazoninGlp-TFQYSRGWTN-NH2≥95.0%1mg¥205
CorazoninGlp-TFQYSRGWTN-NH2≥95.0%5mg¥615
Neurotensin (8-13)RRPYIL≥95.0%1mg¥90
Neurotensin (8-13)RRPYIL≥95.0%5mg¥270
Obestatin (human)FNAPFDVGIKLSGVQYQQHSQAL-NH2≥95.0%1mg¥378
Obestatin (human)FNAPFDVGIKLSGVQYQQHSQAL-NH2≥95.0%5mg¥1,134
Nociceptin / Orphanin FQFGGFTGARKSARKLANQ≥95.0%1mg¥254
Nociceptin / Orphanin FQFGGFTGARKSARKLANQ≥95.0%5mg¥762
Orexin B, canineRPGPPGLQGRLQRLLQASGNHAAGILTM-NH2≥95.0%1mg¥458
Orexin B, canineRPGPPGLQGRLQRLLQASGNHAAGILTM-NH2≥95.0%5mg¥1,374
Orexin B, humanRSGPPGLQGRLQRLLQASGNHAAGILTM-NH2≥95.0%1mg¥458
Orexin B, humanRSGPPGLQGRLQRLLQASGNHAAGILTM-NH2≥95.0%5mg¥1,374
PACAP (1-38), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2≥95.0%1mg¥684
PACAP (1-38), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2≥95.0%5mg¥2,052
PACAP-Related Peptide (PRP), ratDVAHEILNEAYRKVLDQLSARKYLQSMVA≥95.0%1mg¥464
PACAP-Related Peptide (PRP), ratDVAHEILNEAYRKVLDQLSARKYLQSMVA≥95.0%5mg¥1,392
PACAP-Related Peptide (PRP), humanDVAHGILNEAYRKVLDQLSAGKHLQSLVA≥95.0%1mg¥464
PACAP-Related Peptide (PRP), humanDVAHGILNEAYRKVLDQLSAGKHLQSLVA≥95.0%5mg¥1,392
PACAP (1-27), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2≥95.0%1mg¥442
PACAP (1-27), human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2≥95.0%5mg¥1,326
PACAP (6-27), human, ovine, ratFTDSYSRYRKQMAVKKYLAAVL-NH2≥95.0%1mg¥362
PACAP (6-27), human, ovine, ratFTDSYSRYRKQMAVKKYLAAVL-NH2≥95.0%5mg¥1,086
Chromostatin, bovineSDEDSDGDRPQASPGLGPGP≥95.0%1mg¥300
Chromostatin, bovineSDEDSDGDRPQASPGLGPGP≥95.0%5mg¥900
Pancreatic Polypeptide (rat)APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2≥95.0%1mg¥684
Pancreatic Polypeptide (rat)APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2≥95.0%5mg¥2,052
Pancreatic Polypeptide (human)APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2≥95.0%1mg¥684
Pancreatic Polypeptide (human)APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2≥95.0%5mg¥2,052
Insulin B (9 - 23)SHLVEALYLVCGERG≥95.0%1mg¥210
Insulin B (9 - 23)SHLVEALYLVCGERG≥95.0%5mg¥630
PAR - 1 Agonist;Protease - Activated Receptor - 1TFLLRN≥95.0%1mg¥90
PAR - 1 Agonist;Protease - Activated Receptor - 1TFLLRN≥95.0%5mg¥270
PAR-4 (1-6) amide (human)GYPGQV-NH2≥95.0%1mg¥100
PAR-4 (1-6) amide (human)GYPGQV-NH2≥95.0%5mg¥300
PAR-4 (1-6) (human)GYPGQV≥95.0%1mg¥90
PAR-4 (1-6) (human)GYPGQV≥95.0%5mg¥270
PAR-4 (1-6) amide (mouse)GYPGKF-NH2≥95.0%1mg¥100
PAR-4 (1-6) amide (mouse)GYPGKF-NH2≥95.0%5mg¥300
PAR-4 (1-6) (mouse)GYPGKF≥95.0%1mg¥90
PAR-4 (1-6) (mouse)GYPGKF≥95.0%5mg¥270
P34cdc2 Kinase Substrate PeptideADAQHATPPKKKRKVEDPKDF≥95.0%1mg¥315
P34cdc2 Kinase Substrate PeptideADAQHATPPKKKRKVEDPKDF≥95.0%5mg¥945
Tyrosinase (206-214), humanAFLPWHRLF≥95.0%1mg¥136
Tyrosinase (206-214), humanAFLPWHRLF≥95.0%5mg¥408
Substrate for Tyrosine Protein KinaseRRLIEDNEYTARG≥95.0%1mg¥194
Substrate for Tyrosine Protein KinaseRRLIEDNEYTARG≥95.0%5mg¥582
S6-1RRLSSLRA≥95.0%1mg¥122
S6-1RRLSSLRA≥95.0%5mg¥366
Phosphate Acceptor PeptideRRKASGPPV≥95.0%1mg¥136
Phosphate Acceptor PeptideRRKASGPPV≥95.0%5mg¥408
MalantideRTKRSGSVYEPLKI≥95.0%1mg¥210
MalantideRTKRSGSVYEPLKI≥95.0%5mg¥630
QKRPSQRSKYLQKRPSQRSKYL≥95.0%1mg¥150
QKRPSQRSKYLQKRPSQRSKYL≥95.0%5mg¥450
Protease-Activated Receptor-2, PAR-2 Agonist, amideSLIGKV-NH2≥95.0%1mg¥110
Protease-Activated Receptor-2, PAR-2 Agonist, amideSLIGKV-NH2≥95.0%5mg¥330
MelittinGIGAVLKVLTTGLPALISWIKRKRQQ-NH2≥95.0%1mg¥426
MelittinGIGAVLKVLTTGLPALISWIKRKRQQ-NH2≥95.0%5mg¥1,278
KemptideLRRASLG≥95.0%1mg¥90
KemptideLRRASLG≥95.0%5mg¥270
Phosphorylase Kinase b-Subunit (420-436)KRNPGSQKRFPSNCGRD≥95.0%1mg¥255
Phosphorylase Kinase b-Subunit (420-436)KRNPGSQKRFPSNCGRD≥95.0%5mg¥765
Myosin Kinase Inhibiting PeptideKKRAARATS-NH2≥95.0%1mg¥145
Myosin Kinase Inhibiting PeptideKKRAARATS-NH2≥95.0%5mg¥435
Syntide 2PLARTLSVAGLPGKK≥95.0%1mg¥225
Syntide 2PLARTLSVAGLPGKK≥95.0%5mg¥675
Tyrosinase (192-200), human mouseSEIWRDIDF≥95.0%1mg¥135
Tyrosinase (192-200), human mouseSEIWRDIDF≥95.0%5mg¥405
Tyr-Ile-Tyr-Gly-Ser-Phe-LysYIYGSFK≥95.0%1mg¥105
Tyr-Ile-Tyr-Gly-Ser-Phe-LysYIYGSFK≥95.0%5mg¥315
Casein Kinase II SubstrateRRREEETEEE≥95.0%1mg¥210
Casein Kinase II SubstrateRRREEETEEE≥95.0%5mg¥630
RREEETEEERREEETEEE≥95.0%1mg¥189
RREEETEEERREEETEEE≥95.0%5mg¥567
Ser25] Protein Kinase C (19-31)RFARKGSLRQKNV≥95.0%1mg¥195
Ser25] Protein Kinase C (19-31)RFARKGSLRQKNV≥95.0%5mg¥585
[Ala9] Autocamtide 2KKALRRQEAVDAL≥95.0%1mg¥195
[Ala9] Autocamtide 2KKALRRQEAVDAL≥95.0%5mg¥585
Autocamtide 2KKALRRQETVDAL≥95.0%1mg¥195
Autocamtide 2KKALRRQETVDAL≥95.0%5mg¥585
cAMP Dependent PK Inhibitor (5-22), amideTTYADFIASGRTGRRNAI-NH2≥95.0%1mg¥280
cAMP Dependent PK Inhibitor (5-22), amideTTYADFIASGRTGRRNAI-NH2≥95.0%5mg¥840
RR-SRCRRLIEDAEYAARG≥95.0%1mg¥195
RR-SRCRRLIEDAEYAARG≥95.0%5mg¥585
Protein Kinase C (19-35) PeptideRFARKGALRQKNVHEVK≥95.0%1mg¥255
Protein Kinase C (19-35) PeptideRFARKGALRQKNVHEVK≥95.0%5mg¥765
Protein Kinase C (gamma) PeptideNYPLELYERVRTGC≥95.0%1mg¥210
Protein Kinase C (gamma) PeptideNYPLELYERVRTGC≥95.0%5mg¥630
5FAM-RQMSFRL5FAM-RQMSFRL≥95.0%1mg¥276
5FAM-RQMSFRL5FAM-RQMSFRL≥95.0%5mg¥828
5FAM-RKRRQTSM5FAM-RKRRQTSM≥95.0%1mg¥294
5FAM-RKRRQTSM5FAM-RKRRQTSM≥95.0%5mg¥882
5FAM-RKRSRAEA-NH25FAM-RKRSRAEA-NH2≥95.0%1mg¥304
5FAM-RKRSRAEA-NH25FAM-RKRSRAEA-NH2≥95.0%5mg¥912
5FAM-RPRTSSF5FAM-RPRTSSF≥95.0%1mg¥276
5FAM-RPRTSSF5FAM-RPRTSSF≥95.0%5mg¥828
5FAM-RTKRSGSVYEPLKI-NH25FAM-RTKRSGSVYEPLKI-NH2≥95.0%1mg¥420
5FAM-RTKRSGSVYEPLKI-NH25FAM-RTKRSGSVYEPLKI-NH2≥95.0%5mg¥1,260
5FAM-NVKSKIGSTENLK-NH25FAM-NVKSKIGSTENLK-NH2≥95.0%1mg¥402
5FAM-NVKSKIGSTENLK-NH25FAM-NVKSKIGSTENLK-NH2≥95.0%5mg¥402
5FAM-DEEIYEELK-NH25FAM-DEEIYEELK-NH2≥95.0%1mg¥322
5FAM-DEEIYEELK-NH25FAM-DEEIYEELK-NH2≥95.0%5mg¥966
5FAM-QNPSRCSVSLSNVEA-NH25FAM-QNPSRCSVSLSNVEA-NH2≥95.0%1mg¥438
5FAM-QNPSRCSVSLSNVEA-NH25FAM-QNPSRCSVSLSNVEA-NH2≥95.0%5mg¥1,314
5FAM-ERRKSKSGA-NH25FAM-ERRKSKSGA-NH2≥95.0%1mg¥312
5FAM-ERRKSKSGA-NH25FAM-ERRKSKSGA-NH2≥95.0%5mg¥936
Hypercalcemia Malignancy Factor (1-34), humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA≥95.0%1mg¥578
Hypercalcemia Malignancy Factor (1-34), humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA≥95.0%5mg¥1,734
Hypercalcemia Malignancy Factor (1-34), amide, humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2≥95.0%1mg¥588
Hypercalcemia Malignancy Factor (1-34), amide, humanAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2≥95.0%5mg¥1,764
Parathyroid Hormone (1-34), ratAVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF≥95.0%1mg¥578
Parathyroid Hormone (1-34), ratAVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF≥95.0%5mg¥1,734
Parathyroid Hormone (1-34), bovineAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF≥95.0%1mg¥578
Parathyroid Hormone (1-34), bovineAVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF≥95.0%5mg¥1,734
Angiotensinogen (1-14), humanDRVYIHPFHLVIHN≥95.0%1mg¥210
Angiotensinogen (1-14), humanDRVYIHPFHLVIHN≥95.0%5mg¥630
Acetyl Angiotensinogen (1-14), porcineAc-DRVYIHPFHLLVYS≥95.0%1mg¥220
Acetyl Angiotensinogen (1-14), porcineAc-DRVYIHPFHLLVYS≥95.0%5mg¥660
Acetyl, Angiotensinogen (1-14), humanAc-DRVYIHPFHLVIHN≥95.0%1mg¥220
Acetyl, Angiotensinogen (1-14), humanAc-DRVYIHPFHLVIHN≥95.0%5mg¥660
Renin Substrate Tetradecapeptide, ratDRVYIHPFHLLYYS≥95.0%1mg¥210
Renin Substrate Tetradecapeptide, ratDRVYIHPFHLLYYS≥95.0%5mg¥630
Angiotensinogen (1-14), porcineDRVYIHPFHLLVYS≥95.0%1mg¥210
Angiotensinogen (1-14), porcineDRVYIHPFHLLVYS≥95.0%5mg¥630
Angiotensinogen (1-13), humanDRVYIHPFHLVIH≥95.0%1mg¥195
Angiotensinogen (1-13), humanDRVYIHPFHLVIH≥95.0%5mg¥585
P-H-P-F-H-F-F-V-Y-KPHPFHFFVYK≥95.0%1mg¥150
P-H-P-F-H-F-F-V-Y-KPHPFHFFVYK≥95.0%5mg¥450
[Cys8] Renin Substrate Tetradecapeptide, ratDRVYIHPCHLLYYS≥95.0%1mg¥210
[Cys8] Renin Substrate Tetradecapeptide, ratDRVYIHPCHLLYYS≥95.0%5mg¥630
[Leu8] Renin Substrate Tetradecapeptide, ratDRVYIHPLHLLYYS≥95.0%1mg¥210
[Leu8] Renin Substrate Tetradecapeptide, ratDRVYIHPLHLLYYS≥95.0%5mg¥630
[Val8] Renin Substrate Tetradecapeptide, ratDRVYIHPVHLLYYS≥95.0%1mg¥210
[Val8] Renin Substrate Tetradecapeptide, ratDRVYIHPVHLLYYS≥95.0%5mg¥630
Secretin, ratHSDGTFTSELSRLQDSARLQRLLQGLV-NH2≥95.0%1mg¥417
Secretin, ratHSDGTFTSELSRLQDSARLQRLLQGLV-NH2≥95.0%5mg¥1,251
Secretin (5-27), porcineTFTSELSRLRDSARLQRLLQGLV-NH2≥95.0%1mg¥332
Secretin (5-27), porcineTFTSELSRLRDSARLQRLLQGLV-NH2≥95.0%5mg¥996
Secretin, humanHSDGTFTSELSRLREGARLQRLLQGLV-NH2≥95.0%1mg¥442
Secretin, humanHSDGTFTSELSRLREGARLQRLLQGLV-NH2≥95.0%5mg¥1,362
SelankTKPRPGP≥98.0%1mg¥108
SelankTKPRPGP≥98.0%5mg¥324
Somatostatin 28 (1-14)SANSNPAMAPRERK≥95.0%1mg¥210
Somatostatin 28 (1-14)SANSNPAMAPRERK≥95.0%5mg¥630
Somatostatin1-14AGCKNFFWKTFTSC (C3&C14 bridge)≥95.0%1mg¥320
Somatostatin1-14AGCKNFFWKTFTSC (C3&C14 bridge)≥95.0%5mg¥960
RC-160 (Vapreotide)fCYwKVCW-NH2 (C2&C7 bridge)≥95.0%1mg¥300
RC-160 (Vapreotide)fCYwKVCW-NH2 (C2&C7 bridge)≥95.0%5mg¥900
NTB (Naltriben)DPhe-CY-DTrp-Orn-T-Pen-T-NH2(Cys2&Pen7 bridge)≥95.0%1mg¥300
NTB (Naltriben)DPhe-CY-DTrp-Orn-T-Pen-T-NH2(Cys2&Pen7 bridge)≥95.0%5mg¥900
[DPro2,DPhe7,DTrp9] Substance PR-DPro-KPQQ-DPhe-F-DTrp-LM-NH2≥95.0%1mg¥265
[DPro2,DPhe7,DTrp9] Substance PR-DPro-KPQQ-DPhe-F-DTrp-LM-NH2≥95.0%5mg¥795
MG-132RPKPQQFFGLM-NH2≥95.0%1mg¥175
MG-132RPKPQQFFGLM-NH2≥95.0%5mg¥525
Pep-1KETWWETWWTEWSQPKKKRKV≥95.0%1mg¥336
Pep-1KETWWETWWTEWSQPKKKRKV≥95.0%5mg¥1,008
HIV-1 TAT Protein PeptideYGRKKRRQRRR≥95.0%1mg¥165
HIV-1 TAT Protein PeptideYGRKKRRQRRR≥95.0%5mg¥495
TAT 2-4YGRKKRRQRRRGYGRKKRRQRRRG≥95.0%1mg¥384
TAT 2-4YGRKKRRQRRRGYGRKKRRQRRRG≥95.0%5mg¥1,152
Scrambled TRAP FragmentFSLLRN-NH2≥95.0%1mg¥102
Scrambled TRAP FragmentFSLLRN-NH2≥95.0%5mg¥306
Hemoglobin (Hb) (64-76)GKKVITAFNEGLK≥95.0%1mg¥195
Hemoglobin (Hb) (64-76)GKKVITAFNEGLK≥95.0%5mg¥585
Thymopoietin II (32-34)RKD≥95.0%1mg¥60
Thymopoietin II (32-34)RKD≥95.0%5mg¥180
Thymopoietin II (32-35)RKDV≥95.0%1mg¥80
Thymopoietin II (32-35)RKDV≥95.0%5mg¥240
ThymopentinRKDVY≥95.0%1mg¥80
ThymopentinRKDVY≥95.0%5mg¥240
Urocortin II, humanIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC-NH2≥95.0%1mg¥748
Urocortin II, humanIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC-NH2≥95.0%5mg¥2,244
Urocortin III, mouseFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2≥95.0%1mg¥694
Urocortin III, mouseFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2≥95.0%5mg¥2,082
Urocortin III, humanFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2≥95.0%1mg¥694
Urocortin III, humanFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2≥95.0%5mg¥2,082
Urocortin, humanDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2≥95.0%1mg¥735
Urocortin, humanDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2≥95.0%5mg¥2,205
Urocortin, ratDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2≥95.0%1mg¥735
Urocortin, ratDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2≥95.0%5mg¥2,205
Urocortin III, mouse, free acidFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI≥95.0%1mg¥684
Urocortin III, mouse, free acidFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI≥95.0%5mg¥2,052
Urotensin INDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2≥95.0%1mg¥738
Urotensin INDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2≥95.0%5mg¥2,214
VIP, human, porcine, rat, ovineHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2≥95.0%1mg¥486
VIP, human, porcine, rat, ovineHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2≥95.0%5mg¥1,458
PHI, ratHADGVFTSDYSRLLGQISAKKYLESLI-NH2≥95.0%1mg¥469
PHI, ratHADGVFTSDYSRLLGQISAKKYLESLI-NH2≥95.0%5mg¥1,407
VIP, guinea pigHSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2≥95.0%1mg¥458
VIP, guinea pigHSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2≥95.0%5mg¥1,374
Peptide TASTTTNYT≥95.0%1mg¥120
Peptide TASTTTNYT≥95.0%5mg¥360
R15K, HIV-1 Inhibitory PeptideRIQRGPGRAFVTIGK≥95.0%1mg¥225
R15K, HIV-1 Inhibitory PeptideRIQRGPGRAFVTIGK≥95.0%5mg¥675